Mouse Anti-AK7 Antibody (CBMOAB-1985FYC)
Cat: CBMOAB-1985FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-1985FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) | WB, ELISA | MO1985FC | 100 µg | ||
CBMOAB-35401FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO35401FYA | 100 µg | ||
MO-AB-01322H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01322C | 100 µg | ||
MO-AB-07179R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07179R | 100 µg | ||
MO-AB-50645W | Monoclonal | Marmoset | WB, ELISA | MO50645W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) |
Clone | MO1985FC |
Specificity | This antibody binds to Arabidopsis AK7. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the adenylate kinase family of enzymes. The encoded enzyme is a phosphotransferase that catalyzes the reversible phosphorylation of adenine nucleotides. This enzyme plays a role in energy homeostasis of the cell. Alternative splicing results in multiple transcript variants. Mutations in the mouse gene are associated with primary ciliary dyskinesia. (From NCBI) |
Product Overview | Mouse Anti-Arabidopsis AK7 Antibody is a mouse antibody against AK7. It can be used for AK7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate Kinase 7; ATP-AMP Transphosphorylase 7; EC 2.7.4.3; EC 2.7.4.6; AK 7 |
UniProt ID | Q38994 |
Protein Refseq | The length of the protein is 55 amino acids long. The sequence is show below: SNILLDAEMNPKVADFGTARLFDSDETRAETKRIAGTRGYMAPEYLNHGQISAKS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry