Mouse Anti-AK7 Antibody (CBMOAB-1985FYC)


Cat: CBMOAB-1985FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-1985FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO1985FC 100 µg
CBMOAB-35401FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO35401FYA 100 µg
MO-AB-01322H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01322C 100 µg
MO-AB-07179R Monoclonal Cattle (Bos taurus) WB, ELISA MO07179R 100 µg
MO-AB-50645W Monoclonal Marmoset WB, ELISA MO50645W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO1985FC
SpecificityThis antibody binds to Arabidopsis AK7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the adenylate kinase family of enzymes. The encoded enzyme is a phosphotransferase that catalyzes the reversible phosphorylation of adenine nucleotides. This enzyme plays a role in energy homeostasis of the cell. Alternative splicing results in multiple transcript variants. Mutations in the mouse gene are associated with primary ciliary dyskinesia. (From NCBI)
Product OverviewMouse Anti-Arabidopsis AK7 Antibody is a mouse antibody against AK7. It can be used for AK7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate Kinase 7; ATP-AMP Transphosphorylase 7; EC 2.7.4.3; EC 2.7.4.6; AK 7
UniProt IDQ38994
Protein RefseqThe length of the protein is 55 amino acids long. The sequence is show below: SNILLDAEMNPKVADFGTARLFDSDETRAETKRIAGTRGYMAPEYLNHGQISAKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry