Mouse Anti-AK8 Antibody (CBMOAB-1986FYC)
Cat: CBMOAB-1986FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-1986FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO1986FC | 100 µg | ||
CBMOAB-65360FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65360FYA | 100 µg | ||
MO-AB-50646W | Monoclonal | Marmoset | WB, ELISA | MO50646W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Marmoset, Zebrafish (Danio rerio) |
Clone | MO1986FC |
Specificity | This antibody binds to Arabidopsis AK8. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP. Also displays broad nucleoside diphosphate kinase activity. |
Product Overview | Mouse Anti-Arabidopsis AK8 Antibody is a mouse antibody against AK8. It can be used for AK8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate Kinase 8; ATP-AMP Transphosphorylase 8; C9orf98; AK 8; Putative Adenylate Kinase-Like Protein C9orf98; Chromosome 9 Open Reading Frame 98; EC 2.7.4.3; EC 2.7.4.6; DDX31 |
UniProt ID | Q38995 |
Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: KAGNILLDAHMNPKVADFGTARIFGMDQSVAITANAAGTPGYMAPEYMELGEFSMKS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry