AibGenesis™ Mouse Anti-AK8 Antibody (CBMOAB-1986FYC)


Cat: CBMOAB-1986FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-1986FYC Monoclonal A. thaliana (Arabidopsis thaliana), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO1986FC 100 µg
CBMOAB-65360FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65360FYA 100 µg
MO-AB-50646W Monoclonal Marmoset WB, ELISA MO50646W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Marmoset, Zebrafish (Danio rerio)
CloneMO1986FC
SpecificityThis antibody binds to Arabidopsis AK8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AK8 Antibody is a mouse antibody against AK8. It can be used for AK8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate Kinase 8; ATP-AMP Transphosphorylase 8; C9orf98; AK 8; Putative Adenylate Kinase-Like Protein C9orf98; Chromosome 9 Open Reading Frame 98; EC 2.7.4.3; EC 2.7.4.6; DDX31
UniProt IDQ38995
Protein RefseqThe length of the protein is 57 amino acids long. The sequence is show below: KAGNILLDAHMNPKVADFGTARIFGMDQSVAITANAAGTPGYMAPEYMELGEFSMKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry