AibGenesis™ Mouse Anti-Akap4 Antibody (CBMOAB-00785FYA)


Cat: CBMOAB-00785FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00785FYA Monoclonal Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Rhesus (Macaca mulatta) WB, ELISA MO00785FYA 100 µg
CBMOAB-35421FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO35421FYA 100 µg
CBMOAB-60351FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60351FYC 100 µg
MO-AB-43618W Monoclonal Horse (Equus caballus) WB, ELISA MO43618W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Horse (Equus caballus), Rhesus (Macaca mulatta)
CloneMO00785FYA
SpecificityThis antibody binds to fruit fly Akap4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Akap4 Antibody is a mouse antibody against Akap4. It can be used for Akap4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesImportin subunit alpha; aKap4
UniProt IDG9LQY8
Protein RefseqThe length of the protein is 442 amino acids long.
The sequence is show below: MQKRKRRFLKKGQNLMMLRTLRLEKAKKAELQKELTIYNALTKCKLTSSEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVLRKLCISSQPSPPDNAAEIIQALNIVLYNPEANVLEDALMAVRNLAHGNETIQMLLDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNIADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCNLLFCQERDILSNVLDILSTILDVDPSFSAEVSGIIEWSGALNNIRMLQSSEHEEIAAVARKIIGNYFPAKPHIATKF.
For Research Use Only | Not For Clinical Use.
Online Inquiry