Mouse Anti-Akh Antibody (CBMOAB-00790FYA)


Cat: CBMOAB-00790FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00790FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) WB, ELISA MO00790FYA 100 µg
MO-AB-00100Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00100Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus)
CloneMO00790FYA
SpecificityThis antibody binds to fruit fly Akh.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbably causes a marked increase in hemolymph carbohydrate.
Product OverviewMouse Anti-D. melanogaster Akh Antibody is a mouse antibody against Akh. It can be used for Akh detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdipokinetic hormone; Hypertrehalosaemic hormone; HRTH; dAKH; Akh
UniProt IDP61855
Protein RefseqThe length of the protein is 79 amino acids long.
The sequence is show below: MNPKSEVLIAAVLFMLLACVQCQLTFSPDWGKRSVGGAGPGTFFETQQGNCKTSNEMLLEIFRFVQSQAQLFLDCKHRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry