Mouse Anti-Akh Antibody (CBMOAB-00790FYA)
Cat: CBMOAB-00790FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) |
Clone | MO00790FYA |
Specificity | This antibody binds to fruit fly Akh. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Probably causes a marked increase in hemolymph carbohydrate. |
Product Overview | Mouse Anti-D. melanogaster Akh Antibody is a mouse antibody against Akh. It can be used for Akh detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adipokinetic hormone; Hypertrehalosaemic hormone; HRTH; dAKH; Akh |
UniProt ID | P61855 |
Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MNPKSEVLIAAVLFMLLACVQCQLTFSPDWGKRSVGGAGPGTFFETQQGNCKTSNEMLLEIFRFVQSQAQLFLDCKHRE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry