Mouse Anti-alad Antibody (CBMOAB-65440FYA)
Cat: CBMOAB-65440FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-65440FYA | Monoclonal | Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO65440FYA | 100 µg | ||
MO-AB-00031L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00031L | 100 µg | ||
MO-AB-00039R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00039R | 100 µg | ||
MO-AB-01341H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01341C | 100 µg | ||
MO-AB-06276Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06276Y | 100 µg | ||
MO-AB-07150Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07150Y | 100 µg | ||
MO-AB-07209R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07209R | 100 µg | ||
MO-AB-08937W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08937W | 100 µg | ||
MO-AB-14153Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14153Y | 100 µg | ||
MO-AB-21744W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21744W | 100 µg | ||
MO-AB-22831H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO22831C | 100 µg | ||
MO-AB-24026H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24026C | 100 µg | ||
MO-AB-28909W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28909W | 100 µg | ||
MO-AB-32821H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32821C | 100 µg | ||
MO-AB-34358W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34358W | 100 µg | ||
MO-AB-41205W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41205W | 100 µg | ||
MO-AB-43621W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43621W | 100 µg | ||
MO-AB-50682W | Monoclonal | Marmoset | WB, ELISA | MO50682W | 100 µg | ||
MO-DKB-02105W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO65440FYA |
Specificity | This antibody binds to Zebrafish alad. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. (From NCBI) |
Product Overview | Mouse Anti-Zebrafish alad Antibody is a mouse antibody against alad. It can be used for alad detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Delta-aminolevulinic acid dehydratase; EC 4.2.1.24; alad; zgc:11021 |
UniProt ID | Q568L9 |
Protein Refseq | The length of the protein is 331 amino acids long. The sequence is show below: MTQPAESILHSGYFHPTLRYWQTCASELRPDNLIYPIFITDSPDAVEPIASLPGQARYGVNKIEGLLRPLVDKGLKCVLIFGVPAKVAKDERGSGADADDTPAVLAVKKLRSTFPELVLACDVCLCPYTSHGHCGILREDGSLDNAASCLRLAEVALAYARAGCHIIAPSDMMDGRIAAIKQALIANDLGNKVSVLSYSAKFASCYYGPFRDAAQSKPAFGDRRCYQLPPGARGLALRACDRDVKEGADMLMVKPGLPYLDIVREVKNKHPTHPLAVYNVSGEFAMLWHGAEAGAFDLRTAVMEAMTAFRRAGADIIITYYTPQLLIWLTE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry