Mouse Anti-ALD1 Antibody (CBMOAB-18560FYB)


Cat: CBMOAB-18560FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18560FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO18560FYB 100 µg
CBMOAB-2037FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO2037FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO18560FYB
SpecificityThis antibody binds to Rice ALD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable aminotransferase that may generate amino-acid-derived defense signals and be involved in resistance to pathogens.
Product OverviewMouse Anti-Rice ALD1 Antibody is a mouse antibody against ALD1. It can be used for ALD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAminotransferase ALD1 homolog; EC 2.6.1.-; ALD1; Os03g0195100 LOC_Os03g09910
UniProt IDQ6VMN7
Protein RefseqThe length of the protein is 440 amino acids long.
The sequence is show below: MPVNMISKLLEKAVLPALDVAPPVKIGGPRRTSVLRNPNMEKLQKGYLFPEISIKREEHLKKYPDAKVISLGIGDTTEPIPSIVTSAMAEYALALSTPEGYQGYGPEQGHKNLRKEIADKVYPDMGIKESEVFISDGAQCDIARLQTLFGPNVTIAVQDPTFPGYVDNGVIMGQTGKADDGGRYAGIEYMRCAPENAFFPDLSRVRRTDVIFFCSPNNPTGHAASREQLRQLVELARRNGSIIVFDSAYSSYISSSSSSSTPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWAVVPDELLYSDGVPVARDFDRVVCTCFNGASGIAQAGGVACLSTEEGRGAVARVVGVYRENARVLVETFRSLGKEVHGGGDAPYVWVRFPGRRSWDVFAEILEKTHVITVPGSGFGPGGEGFIRVSAFNSRDKVLEACQRLKSFLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry