AibGenesis™ Mouse Anti-Alg-2 Antibody (CBMOAB-00852FYA)


Cat: CBMOAB-00852FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00852FYA Monoclonal Fruit fly (Drosophila melanogaster), Silkworm (Bombyx mori) WB, ELISA MO00852FYA 100 µg
MO-AB-68790W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO68790W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Silkworm (Bombyx mori)
CloneMO00852FYA
SpecificityThis antibody binds to fruit fly Alg-2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Alg-2 Antibody is a mouse antibody against Alg-2. It can be used for Alg-2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApoptosis-linked gene-2; Alg-2
UniProt IDA8Y589
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSLKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry