AibGenesis™ Mouse Anti-ALG12 Antibody (MO-AB-50730W)


Cat: MO-AB-50730W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-50730W Monoclonal Marmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Yeast, Zebrafish (Danio rerio) WB, ELISA MO50730W 100 µg
CBMOAB-65536FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65536FYA 100 µg
CBMOAB-00212CR Monoclonal Yeast WB, ELISA MO00212CR 100 µg
MO-AB-12121W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12121W 100 µg
MO-AB-07245R Monoclonal Cattle (Bos taurus) WB, ELISA MO07245R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Yeast, Zebrafish (Danio rerio)
CloneMO50730W
SpecificityThis antibody binds to Marmoset ALG12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. (From NCBI)
Product OverviewMouse Anti-Marmoset ALG12 Antibody is a mouse antibody against ALG12. It can be used for ALG12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; ALG12
UniProt IDU3DWF0
Protein RefseqThe length of the protein is 488 amino acids long.
The sequence is show below: MAGKRSSGRRPLLLWLLVAVAAVHLVTCPYTKVEESFALQATHDLLYYRQALGQYDHLEFPGVVPRTFLGPVVIATLSSPAVFVLSLLETSKFYSQLIVRGVLGLGVIFGLWTLQKEVRRQFGAVVATMFCWVTALQFHLMFYCTRTLPNVLVLPVVLLALSAWLGHEWARFIWLSAFAIIVFRAELCLFLGLLLLLALGSRKVSVVRALRHAIPAGVLCLGLTVAVDSYFWRQLMWPEGKVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIPMGLMDRRMHPLTVAAFGFVALYSLLPHKELRFIIYTFPALNITAARGCSYLLNNYKKSWLYKAGSLLVIGHLLANAAYSATALYVSHFNYPGGVAMQRLHQLVPPKTEVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDLQPGAGMLAYTHILMEAAPDLLALYRDTHRVLASIAGTTGVSLNLTQLPPFNVHLQTKLVLLERLPQPS.
For Research Use Only | Not For Clinical Use.
Online Inquiry