Mouse Anti-ALKAL2 Antibody (MO-AB-22598W)


Cat: MO-AB-22598W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-22598W Monoclonal Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO22598W 100 µg
MO-AB-24036H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24036C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO22598W
SpecificityThis antibody binds to Chimpanzee ALKAL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee ALKAL2 Antibody is a mouse antibody against ALKAL2. It can be used for ALKAL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFamily with sequence similarity 150, member B; FAM150B
UniProt IDK7CTX7
Protein RefseqThe length of the protein is 152 amino acids long.
The sequence is show below: MRGPGRPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry