AibGenesis™ Mouse Anti-ALKBH8 Antibody (CBMOAB-35539FYA)


Cat: CBMOAB-35539FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35539FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO35539FYA 100 µg
CBMOAB-65573FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65573FYA 100 µg
MO-AB-07264R Monoclonal Cattle (Bos taurus) WB, ELISA MO07264R 100 µg
MO-AB-15363W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15363W 100 µg
MO-AB-50749W Monoclonal Marmoset WB, ELISA MO50749W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO35539FYA
SpecificityThis antibody binds to Rhesus ALKBH8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its methyltransferase domain (PubMed:20123966, PubMed:20308323). Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA (PubMed:20123966, PubMed:20308323). Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys)(PubMed:20308323). Binds tRNA and catalyzes the iron and alpha-ketoglutarate dependent hydroxylation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its dioxygenase domain, giving rise to 5-(S)-methoxycarbonylhydroxymethyluridine; has a preference for tRNA(Gly) (PubMed:21285950). Required for normal survival after DNA damage (PubMed:20308323). May inhibit apoptosis and promote cell survival and angiogenesis (PubMed:19293182). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus ALKBH8 Antibody is a mouse antibody against ALKBH8. It can be used for ALKBH8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesALKBH8
UniProt IDF7GQ66
Protein RefseqThe length of the protein is 243 amino acids long.
The sequence is show below: YGIPFLLQVGCDRSQNLVDICRERQFQAFVCDALAVPVCSGSCDACISIAVIHHFATAERRVAALQEIVRLLRPGGKALIYVWAMEQEYNKQKSKYLKGNRNSQGKKEEMNSDTSVQRSLVEQMPDMGSRDSASSVPRINDSQEGGCNSRQVSNSKLPIHVNRTSFYSQDVLVPWHLKGNPDKGKPVEPFGPIGSQDPSPVFHRYYHVFREGELEALCRTVSDVRILQSYYDQGNWCVILQKA.
For Research Use Only | Not For Clinical Use.
Online Inquiry