Mouse Anti-Alpha-amylase Antibody (CBMOAB-18568FYB)


Cat: CBMOAB-18568FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18568FYB Monoclonal Rice (Oryza), Zebrafish (Danio rerio) WB, ELISA MO18568FYB 100 µg
CBMOAB-65591FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65591FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Zebrafish (Danio rerio)
CloneMO18568FYB
SpecificityThis antibody binds to Rice Alpha-amylase.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionImportant for breakdown of endosperm starch during germination.
Product OverviewMouse Anti-Rice Alpha-amylase Antibody is a mouse antibody against Alpha-amylase. It can be used for Alpha-amylase detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-amylase; EC 3.2.1.1
UniProt IDB7E3X5
Protein RefseqThe length of the protein is 445 amino acids long.
The sequence is show below: MATGRRLSMILLLLLLGLASGDKILFQGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVSTQGYMPGRLYDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYKDSRGIYCIFEGGTPDGRLDWGPHMICRDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQRELTDWLLWLKSDEVGFDAWRLDFARGYSPEVAKVYIEGTTPVGLAVAELWDSMAYGGDGKPEYNQDAHRQALVDWVDRVGGTASAGMVFDFTTKGIMNTAVEGELWRLIDQQGKAPGVIGWWPAKAVTFVDNHDTGSTQQMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIAALVAVRQRNGVTATSSLKIMLHDADAYVAEIDGKVVMKIGSRYDVSSLIPPGFHLAAHGNGYAVWEKIAAAAAAADHRTSSSASL.
For Research Use Only | Not For Clinical Use.
Online Inquiry