Mouse Anti-ALX3 Antibody (CBMOAB-35570FYA)


Cat: CBMOAB-35570FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35570FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO35570FYA 100 µg
MO-AB-24047H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24047C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO35570FYA
SpecificityThis antibody binds to Rhesus ALX3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nuclear protein with a homeobox DNA-binding domain that functions as a transcriptional regulator involved in cell-type differentiation and development. Preferential methylation of this gene's promoter is associated with advanced-stage neuroblastoma tumors.
Product OverviewMouse Anti-Rhesus ALX3 Antibody is a mouse antibody against ALX3. It can be used for ALX3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesALX3
UniProt IDF6ZUR3
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MDPEHCAPFRVGPAPGPYVASGDEPLGPQGTPAAAPHLHPAPPRGPLLTRFPACGTLEPYLPEPAKPPAKYLQDLGLGPALNGGHFYEGSAEAEEKASKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLRLPLSPGLSDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKMQEGRNPFTAAYDISVLPRTDSHPQLQNSLWASPGSGSPGGPCLVSPEGIPSPCMSPYSHPHGSVTGFVGVPASSVAHPGIYSIHGFPPTLGGHSFEPSSEGDYKSPSLVSLRVKPKEPPGLLNWTT.
For Research Use Only | Not For Clinical Use.
Online Inquiry