AibGenesis™ Mouse Anti-AM1 Antibody (MO-AB-00017W)


Cat: MO-AB-00017W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00017W Monoclonal Barrel medic (Medicago truncatula), Medaka (Oryzias latipes) WB, ELISA MO00017W 100 µg
MO-AB-00049R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00049R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), Medaka (Oryzias latipes)
CloneMO00017W
SpecificityThis antibody binds to Barrel medic AM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Barrel medic AM1 Antibody is a mouse antibody against AM1. It can be used for AM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative cell wall protein; AM1
UniProt IDQ9XHM2
Protein RefseqThe length of the protein is 191 amino acids long.
The sequence is show below: MKFNNRIIFLLVVLAVLIACVAAQGPVGAPPAPGTPPPAEPAPGAPPPPPKGKDAKGKDTPDGDAAKGKDAAPDGAKGKDAAPDGAKGKDAPKEGAKGTVTPPAPAAPGAAPGAAPGTAPAPGGPPPEGAAPSPAKGGAAAPTPGAGTGTSVAPAGASGSTAAKTATGAGNSLKSEVGVSFVAVILGALFA.
For Research Use Only | Not For Clinical Use.
Online Inquiry