AibGenesis™ Mouse Anti-AMACR Antibody (CBMOAB-35573FYA)


Cat: CBMOAB-35573FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35573FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO35573FYA 100 µg
MO-AB-03365W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03365W 100 µg
MO-AB-07281R Monoclonal Cattle (Bos taurus) WB, ELISA MO07281R 100 µg
MO-AB-12656W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12656W 100 µg
MO-AB-50773W Monoclonal Marmoset WB, ELISA MO50773W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO35573FYA
SpecificityThis antibody binds to Rhesus AMACR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. (From NCBI)
Product OverviewMouse Anti-Rhesus AMACR Antibody is a mouse antibody against AMACR. It can be used for AMACR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAMACR
UniProt IDF6ZM85
Protein RefseqThe length of the protein is 390 amino acids long.
The sequence is show below: MALQGILVLELAGLAPGPFCAMVLADFGARVVRVERPGSHYDVSRLGRGKRSLALDLKQPRGAAVLRRLCARSDVLLEPFRSGVMEKLQLGPEILQRDNPRLIYARLTGFGQSGSFSRLAGHDINYLALSGVLSKIGRNGENPYAPLNLLADFAGGGLMCVLGIMMALFERTRSGKGQVIDANMVEGTAYLSSFLWKTQKSSLWEAPRGQNILDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFAAVFAKKTKAEWCQIFDGTDACVTPVLTLEEVVHHDHIKERGSFITNEEQSMSPRPAPLLSNTPAIPSFKRDPFVGEHTEEILDEFGFSREEIDQLKSDKIIESNKASSKFWILYPHTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry