Mouse Anti-amdhd2 Antibody (CBMOAB-65639FYA)


Cat: CBMOAB-65639FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-65639FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Pig (Sus scrofa) WB, ELISA MO65639FYA 100 µg
MO-AB-07287R Monoclonal Cattle (Bos taurus) WB, ELISA MO07287R 100 µg
MO-AB-22588W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22588W 100 µg
MO-AB-23695R Monoclonal Pig (Sus scrofa) WB, ELISA MO23695R 100 µg
MO-AB-41219W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41219W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Pig (Sus scrofa)
CloneMO65639FYA
SpecificityThis antibody binds to Zebrafish amdhd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish amdhd2 Antibody is a mouse antibody against amdhd2. It can be used for amdhd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative N-acetylglucosamine-6-phosphate deacetylase; EC 3.5.1.25; Amidohydrolase domain-containing protein 2; GlcNAc 6-P deacetylase; amdhd2; NP_991244.1;XP_005163800.
UniProt IDQ6P0U0
Protein RefseqThe length of the protein is 404 amino acids long.
The sequence is show below: MPSNKSVSDAPITQFVNCRILKNHKLQWEDLWVREGKILNPEKLFFDEQGFADHRVDCENKIIAPGFIDVQLNGGYGIDFSQASSDIRGGVALVAKKILEHGVTSFCPTLVTSPPHIYHKVIPELRVQDGGPEGAGVLGIHLEGPFISEEKRGAHPPKFLRTFQSGGVADLMETYGQLENVAMVTLAPELTNSAAAIHELSSRGITVSVGHSMADLSQAEEAVQNGATFITHLFNAMLPFHHRDPGIVGLLTSDRIPPGRTVYYGMIADGIHTHPAALRIAHRAHPAGLVLVTDAVTAMGLPPGRHTLGQQQIDIQGLHAYVAGTTTLSGSIATMDMCVRHFREASGCTVEAALEAASLHPAQLLGISHRKGTLEFGADADFIVLDDMLTVRETYIAGQQVWRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry