Mouse Anti-AMT1-3 Antibody (CBMOAB-18584FYB)


Cat: CBMOAB-18584FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18584FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO18584FYB 100 µg
CBMOAB-2128FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO2128FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO18584FYB
SpecificityThis antibody binds to Rice AMT1-3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAmmonium transporter probably involved in ammonium uptake from the soil.
Product OverviewMouse Anti-Rice AMT1-3 Antibody is a mouse antibody against AMT1-3. It can be used for AMT1-3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAmmonium transporter 1 member 3; OsAMT1;3; AMT1-3; AMT1-2; Os02g0620500 LOC_Os02g40710
UniProt IDQ6K9G3
Protein RefseqThe length of the protein is 498 amino acids long.
The sequence is show below: MATCLDSLGPLLGGAANSTDAANYICNRFTDTSSAVDATYLLFSAYLVFAMQLGFAMLCAGSVRAKNSMNIMLTNVLDAAAGALFYYLFGFAFAFGTPSKGFIGKQFFGLKHMPQTGYDYDFFLFQWAFAIAAAGITSGSIAERTRFSAYLIYSAFLTGFVYPVVSHWFWSTDGWASAGRLTGPLLFKSGVIDFAGSGVVHLVGGIAGLWGAFIEGPRIGRFDAAGRTVAMKGHSASLVVLGTFLLWFGWFGFNPGSFTTISKIYGESGTIDGQWSAVGRTAVTTSLAGSVAALTTLYGKRWLTGHWNVTDVCNGLLGGFAAITAGCSVVDPWASVICGFVSAWVLIGCNKLSLILKFDDPLEATQLHAGCGAWGIIFTALFARREYVELIYGVPGRPYGLFMGGGGRLLAAHIVQILVIVGWVSATMGTLFYVLHRFGLLRVSPATEMEGMDPTCHGGFGYVDEDEGERRVRAKSAAETARVEPRKSPEQAAAGQFV.
For Research Use Only | Not For Clinical Use.
Online Inquiry