AibGenesis™ Mouse Anti-AMZ1 Antibody (CBMOAB-35626FYA)


Cat: CBMOAB-35626FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35626FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO35626FYA 100 µg
MO-AB-20110W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20110W 100 µg
MO-AB-23713R Monoclonal Pig (Sus scrofa) WB, ELISA MO23713R 100 µg
MO-AB-50805W Monoclonal Marmoset WB, ELISA MO50805W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO35626FYA
SpecificityThis antibody binds to Rhesus AMZ1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionZinc-containing metalloprotease. Demonstrates aminopeptidase activity toward neurogranin under in vitro conditions. Lacks the ability to hydrolyze angiotensin-2.
Product OverviewMouse Anti-Rhesus AMZ1 Antibody is a mouse antibody against AMZ1. It can be used for AMZ1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAMZ1
UniProt IDF6ZCY9
Protein RefseqThe length of the protein is 497 amino acids long.
The sequence is show below: MLQCRHAQEFSFGPRALKDALVSTDAALQQLYVTAFSPAERLFLAEAYNPQRTLFCTLLIRTAFDWLLSRPEAPEDFQTFHASLQHRKPRLARKHIYLQPIDLSEEPVGSSLLRQLCSCTEAFFLGLRVKCLPSVAAASIRCSSRPSRDSDRLQLHTDGILSFLKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHEVGVCSFARFSREFPKSGPSAPDPALVEAADGPEAPLQDRGWALCFSALGMVQCCKVTCHELCHLLGLGNCRWLRCLMQGALSLDEALRRPLDLCPICLRKLQHILGFRLIERYQRLYTWTQAVAGTWPSQEAGEPSVWEDTPPASADSGMCCESDSEPGTSVSEPLTPEACSHAFSSGPEEGLSSLVASEAPPALGGPEEAIKEHERWLAMCIQALQREVAEEELAQVDRAVDALDRWEMFTGQLPAIRQDPPSSNDSVGLRKVLGDKFFSLRRKLSARKLSRAESAPCPWDGEES.
For Research Use Only | Not For Clinical Use.
Online Inquiry