AibGenesis™ Mouse Anti-ANGPT2 Antibody (CBMOAB-35638FYA)


Cat: CBMOAB-35638FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35638FYA Monoclonal Rhesus (Macaca mulatta), Bovine, Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Guinea pig, Marmoset, Pig (Sus scrofa), Rabbit WB, ELISA MO35638FYA 100 µg
MO-AB-00126Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00126Y 100 µg
MO-AB-01035W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01035W 100 µg
MO-AB-07337R Monoclonal Cattle (Bos taurus) WB, ELISA MO07337R 100 µg
MO-AB-23717R Monoclonal Pig (Sus scrofa) WB, ELISA MO23717R 100 µg
MO-AB-28942W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28942W 100 µg
MO-AB-50828W Monoclonal Marmoset WB, ELISA MO50828W 100 µg
MOFY-0622-FY167 Polyclonal Guinea pig WB, IHC, ICC, IP 100 µg
MOFY-0622-FY199 Polyclonal Rabbit WB, IHC, ICC, IP 100 µg
MOFY-0722-FY358 Polyclonal Bovine WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Bovine, Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Guinea pig, Marmoset, Pig (Sus scrofa), Rabbit
CloneMO35638FYA
SpecificityThis antibody binds to Rhesus ANGPT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ANGPT2 Antibody is a mouse antibody against ANGPT2. It can be used for ANGPT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesANGPT2
UniProt IDF6QXG0
Protein RefseqThe length of the protein is 444 amino acids long.
The sequence is show below: MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGVYTLTLPNSTEEVKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF.
For Research Use Only | Not For Clinical Use.
Online Inquiry