Mouse Anti-ANKRD23 Antibody (CBMOAB-35730FYA)


Cat: CBMOAB-35730FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35730FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa) WB, ELISA MO35730FYA 100 µg
MO-AB-23732R Monoclonal Pig (Sus scrofa) WB, ELISA MO23732R 100 µg
MO-AB-50879W Monoclonal Marmoset WB, ELISA MO50879W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa)
CloneMO35730FYA
SpecificityThis antibody binds to Rhesus ANKRD23.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the muscle ankyrin repeat protein (MARP) family and encodes a protein with four tandem ankyrin-like repeats. The protein is localized to the nucleus, functioning as a transcriptional regulator. Expression of this protein is induced during recovery following starvation. (From NCBI)
Product OverviewMouse Anti-Rhesus ANKRD23 Antibody is a mouse antibody against ANKRD23. It can be used for ANKRD23 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnkyrin repeat domain-containing protein 23; ANKRD23
UniProt IDH9F4G8
Protein RefseqThe length of the protein is 296 amino acids long.
The sequence is show below: VSGERVEGKVLGFGRGLPDPGAWPTDWRRGPQEAVAREQLKLEEEKKKKLERFNSSRFNLDNLADLENLVQRRKKRLRHRVPPRKPEPLVKPQPQAQVEPVDLEMFLKAAAENQESLIDKYLTDGGDPSAHDKLHRTALHWACLKGHSQLVNKLLAAGATVDARDLLDRTPVFWACRGGHLDILKQLLNQGARVNARDKIGSTPLHVAVRTRHPDCLEHLIECGAHLNAQDKEGDTALHEAVRHGSYKAMKLLLLYGAELGVRNAASVSPVQLARDWQRGIREALQAHVAHPRTRC.
For Research Use Only | Not For Clinical Use.
Online Inquiry