Mouse Anti-ANS Antibody (MO-AB-00021W)


Cat: MO-AB-00021W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00021W Monoclonal Barrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera), Soybean (Glycine max) WB, ELISA MO00021W 100 µg
MO-AB-00677W Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO00677W 100 µg
MO-AB-31029H Monoclonal Soybean (Glycine max) WB, ELISA MO31029C 100 µg
MO-AB-38834W Monoclonal Grape (Vitis vinifera) WB, ELISA MO38834W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera), Soybean (Glycine max)
CloneMO00021W
SpecificityThis antibody binds to Barrel medic ANS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Barrel medic ANS Antibody is a mouse antibody against ANS. It can be used for ANS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnthocyanidin synthase; Leucoanthocyanidin dioxygenase-like protein; ANS; MTR_5g011250
UniProt IDA8RRU3
Protein RefseqThe length of the protein is 356 amino acids long.
The sequence is show below: MGTVAQRVESLALSGISSIPKEYVRPKEELANIGNIFDEEKKEGPQVPTIDLKEINSSDEIVRGKCREKLKKAAEEWGVMHLVNHGISDDLINRLKKAGETFFELPVEEKEKYANDQSSGKIQGYGSKLANNASGQLEWEDYFFHCIFPEDKRDLSIWPKTPADYTKVTSEYAKELRVLASKIMEVLSLELGLEGGRLEKEAGGMEELLLQMKINYYPICPQPELALGVEAHTDVSSLTFLLHNMVPGLQLFYEGKWVTAKCVPDSILMHIGDTIEILSNGKYKSILHRGLVNKEKVRISWAVFCEPPKEKIILKPLPELVTEKEPARFPPRTFAQHIHHKLFRKDEEEKKDDPKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry