AibGenesis™ Mouse Anti-AOX1a Antibody (CBMOAB-18605FYB)


Cat: CBMOAB-18605FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18605FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera) WB, ELISA MO18605FYB 100 µg
CBMOAB-2227FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO2227FC 100 µg
MO-AB-38838W Monoclonal Grape (Vitis vinifera) WB, ELISA MO38838W 100 µg
MO-DKB-00103W Polyclonal A. thaliana (Arabidopsis thaliana) ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera)
CloneMO18605FYB
SpecificityThis antibody binds to Rice AOX1a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice AOX1a Antibody is a mouse antibody against AOX1a. It can be used for AOX1a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquinol oxidase; EC 1.10.3.11; AOX1a; OSJNBa0083N12.11; Os04g0600200
UniProt IDO82807
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: MSSRMAGSAILRHVGGVRLFTASATSPAAAAAAAARPFLAGGEAVPGVWGLRLMSTSSVASTEAAAKAEAKKADAEKEVVVNSYWGIEQSKKLVREDGTEWKWSCFRPWETYTADTSIDLTKHHVPKTLLDKIAYWTVKSLRFPTDIFFQRRYGCRAMMLETVAAVPGMVGGMLLHLRSLRRFEQSGGWIRTLLEEAENERMHLMTFMEVANPKWYERALVITVQGVFFNAYFLGYLLSPKFAHRVVGYLEEEAIHSYTEFLKDLEAGKIDNVPAPAIAIDYWRLPANATLKDVVTVVRADEAHHRDVNHFASDIHYQGMELKQTPAPIGYH.
For Research Use Only | Not For Clinical Use.
Online Inquiry