Mouse Anti-AP1M1 Antibody (CBMOAB-2236FYC)
Cat: CBMOAB-2236FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-2236FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO2236FC | 100 µg | ||
CBMOAB-66019FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66019FYA | 100 µg | ||
MO-AB-01081W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01081W | 100 µg | ||
MO-AB-01460H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01460C | 100 µg | ||
MO-AB-07433R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07433R | 100 µg | ||
MO-AB-23257W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23257W | 100 µg | ||
MO-AB-50991W | Monoclonal | Marmoset | WB, ELISA | MO50991W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO2236FC |
Specificity | This antibody binds to Arabidopsis AP1M1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Golgi apparatus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. (From NCBI) |
Product Overview | Mouse Anti-Arabidopsis AP1M1 Antibody is a mouse antibody against AP1M1. It can be used for AP1M1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adaptor Related Protein Complex 1 Mu 1 Subunit; Clathrin Assembly Protein Complex 1 Mu-1 Medium Chain 1; Adaptor-Related Protein Complex 1 Subunit Mu-1; Golgi Adaptor HA1/AP1 Adaptin Mu-1 Subunit; Adaptor Protein Complex AP-1 Subunit Mu-1; Clathrin Coat-Associated Protein AP47; Clathrin Coat Assembly Protein AP47; AP-Mu Chain Family Member Mu1A; Mu-Adaptin 1; Mu1A-Adaptin; CLTNM; Clathrin Assembly Protein Complex 1 Medium Chain 1; Clathrin Assembly Protein Complex 1, Medium Chain |
UniProt ID | Q9SAC9 |
Protein Refseq | The length of the protein is 428 amino acids long. The sequence is show below: MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIETEGDSQSNDPVAYDNGVTYMFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMDFGYPQFTEARILSEFIKTDAYRMEVTQRPPMAVTNSVSWRSEGLKFKKNEVFLDVIESVNILVNSNGQIVRSDVVGALKMRTYLSGMPECKLGLNDRILLEAQGRAIKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLIWVEAHIERHSRSRVEMLVKARSQFKDRSYATSVEIELPVPTDAYNPDVRTSLGSAAYAPEKDALVWKIQYFYGNKEHTLKADFHLPSIAAEEATPERKAPIRVKFEIPKFIVSGIQVRYLKIIEKSGYQAHPWVRYITMAGEYELRLM. |
For Research Use Only | Not For Clinical Use.
Online Inquiry