AibGenesis™ Mouse Anti-ap1m2 Antibody (CBMOAB-66023FYA)


Cat: CBMOAB-66023FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-66023FYA Monoclonal Zebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO66023FYA 100 µg
CBMOAB-35923FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO35923FYA 100 µg
MO-AB-03373W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03373W 100 µg
MO-AB-50992W Monoclonal Marmoset WB, ELISA MO50992W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta)
CloneMO66023FYA
SpecificityThis antibody binds to Zebrafish ap1m2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish ap1m2 Antibody is a mouse antibody against ap1m2. It can be used for ap1m2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdaptor-related protein complex 1 mu 1 subunit; ap1m
UniProt IDQ6TLG2
Protein RefseqThe length of the protein is 424 amino acids long.
The sequence is show below: MSASAVFVLDLKGKVLICRNYKGDVDMSEIDHFFTLLMQQEEDGLISPVMSHGNVHFLWIKHNNLYLVATTNKNSNASLVYAFLYKLVEVFTEYFKELEEESIQDNFVVVYELLDELMDFGFPQTTDSKILQEYITQQGQKLEVAKTKVPTTVTNAVSWRSEGIRYKKNEVFIDVIESINVLVNANGSVMSSDIVGCIRLKTMLSGMPELRLGLNDRVLFALTGRDKGKTVVMEDVKFHQCVRLSRFESDRTISFIPPDGESELMSYRINTHVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANNVEIRVPVPSDADSPKFKTSTGHAKYVPEKNLVVWSIKSFPGGKEFLMRAHFGLPSVENDELEGKPPITVKFEIPYFPVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTNS.
For Research Use Only | Not For Clinical Use.
Online Inquiry