Mouse Anti-ap2-1 Antibody (CBMOAB-18608FYB)


Cat: CBMOAB-18608FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18608FYB Monoclonal Rice (Oryza), Soybean (Glycine max) WB, ELISA MO18608FYB 100 µg
MO-AB-31046H Monoclonal Soybean (Glycine max) WB, ELISA MO31046C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Soybean (Glycine max)
CloneMO18608FYB
SpecificityThis antibody binds to Rice ap2-1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice ap2-1 Antibody is a mouse antibody against ap2-1. It can be used for ap2-1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP2-1 protein; ap2-1
UniProt IDQ70KU8
Protein RefseqThe length of the protein is 266 amino acids long.
The sequence is show below: MAKRSSPDPASSSPSASSSPSSPSSSSSEDSSSPMSMPCKRRARPRTDKSTGKAKRPKKESKEVVDPSSNGGGGGGGGKRSSIYRGVTRHRWTGRFEAHLWDKNCSTSLQNKKKGRQVYLGAYDSEEAAARAYDLAALKYWGPETVLNFPLEEYEKERSEMEGVSREEYLASLRRRSSGFSRGVSKYRGVARHHHNGRWEARIGRVLGNKYLYLGTFDTQEXAAKAYDLAAIEYRXANAVTNFDISCYLDQPQLLAQLQXEPQLLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry