AibGenesis™ Mouse Anti-AP3 Antibody (CBMOAB-18619FYB)


Cat: CBMOAB-18619FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18619FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera), Tomato (Lycopersicon esculentum) WB, ELISA MO18619FYB 100 µg
CBMOAB-2245FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO2245FC 100 µg
MO-AB-34161H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34161C 100 µg
MO-AB-38850W Monoclonal Grape (Vitis vinifera) WB, ELISA MO38850W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Grape (Vitis vinifera), Tomato (Lycopersicon esculentum)
CloneMO18619FYB
SpecificityThis antibody binds to Rice AP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice AP3 Antibody is a mouse antibody against AP3. It can be used for AP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP3-like MADS-box transcription factor; AP3
UniProt IDM1EAX6
Protein RefseqThe length of the protein is 133 amino acids long.
The sequence is show below: RIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCSPSTDIKGIFDRYQQAIGTSLWIEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDGLEFDELRGLEQNVDAALKEVRHRKYHV.
For Research Use Only | Not For Clinical Use.
Online Inquiry