AibGenesis™ Mouse Anti-APC11 Antibody (CBMOAB-00245CR)


Cat: CBMOAB-00245CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00245CR Monoclonal Yeast, A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans) WB, ELISA MO00245CR 100 µg
CBMOAB-00555HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO00555HB 100 µg
CBMOAB-2255FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO2255FC 100 µg
MO-AB-00069H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00069C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans)
CloneMO00245CR
SpecificityThis antibody binds to Yeast APC11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbably catalytic subunit of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome. In early mitosis, the APC/C is activated by CDC20 and targets securin PDS1, the B-type cyclin CLB5, and other anaphase inhibitory proteins for proteolysis, thereby triggering the separation of sister chromatids at the metaphase-to-anaphase transition. In late mitosis and in G1, degradation of CLB5 allows activation of the APC/C by CDH1, which is needed to destroy CDC20 and the B-type cyclin CLB2 to allow exit from mitosis and creating the low CDK state necessary for cytokinesis and for reforming prereplicative complexes in G1 prior to another round of replication. APC11 is required to recruit the ubiquitin-conjugating enzyme E2 to the APC/C. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Yeast APC11 Antibody is a mouse antibody against APC11. It can be used for APC11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnaphase-promoting complex subunit 11; EC 6.3.2; APC11; YDL008W
UniProt IDQ12157
Protein RefseqThe length of the protein is 165 amino acids long. The sequence is show below: MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSRRREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry