AibGenesis™ Mouse Anti-APC11 Antibody (CBMOAB-00245CR)
Cat: CBMOAB-00245CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00245CR | Monoclonal | Yeast, A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans) | WB, ELISA | MO00245CR | 100 µg | ||
| CBMOAB-00555HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO00555HB | 100 µg | ||
| CBMOAB-2255FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO2255FC | 100 µg | ||
| MO-AB-00069H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00069C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans) |
| Clone | MO00245CR |
| Specificity | This antibody binds to Yeast APC11. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Probably catalytic subunit of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome. In early mitosis, the APC/C is activated by CDC20 and targets securin PDS1, the B-type cyclin CLB5, and other anaphase inhibitory proteins for proteolysis, thereby triggering the separation of sister chromatids at the metaphase-to-anaphase transition. In late mitosis and in G1, degradation of CLB5 allows activation of the APC/C by CDH1, which is needed to destroy CDC20 and the B-type cyclin CLB2 to allow exit from mitosis and creating the low CDK state necessary for cytokinesis and for reforming prereplicative complexes in G1 prior to another round of replication. APC11 is required to recruit the ubiquitin-conjugating enzyme E2 to the APC/C. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast APC11 Antibody is a mouse antibody against APC11. It can be used for APC11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Anaphase-promoting complex subunit 11; EC 6.3.2; APC11; YDL008W |
| UniProt ID | Q12157 |
| Protein Refseq | The length of the protein is 165 amino acids long. The sequence is show below: MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSRRREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry