AibGenesis™ Mouse Anti-APLNR Antibody (CBMOAB-36002FYA)


Cat: CBMOAB-36002FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36002FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset WB, ELISA MO36002FYA 100 µg
MO-AB-07480R Monoclonal Cattle (Bos taurus) WB, ELISA MO07480R 100 µg
MO-AB-51084W Monoclonal Marmoset WB, ELISA MO51084W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset
CloneMO36002FYA
SpecificityThis antibody binds to Rhesus APLNR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified. (From NCBI)
Product OverviewMouse Anti-Rhesus APLNR Antibody is a mouse antibody against APLNR. It can be used for APLNR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApelin receptor; APLNR
UniProt IDF7BJB0
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYIGAVATAVLWVLAALLAMPVMVFRTTGDLENTTKVQCYMDYSMVATVSSDWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNVFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD.
For Research Use Only | Not For Clinical Use.
Online Inquiry