Mouse Anti-Apoa1Bp Antibody (CBMOAB-25304FYA)


Cat: CBMOAB-25304FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25304FYA Monoclonal Fruit fly (Drosophila melanogaster), Elephant (Loxodonta africana), Marmoset, Medaka (Oryzias latipes), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO25304FYA 100 µg
CBMOAB-36012FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36012FYA 100 µg
CBMOAB-66142FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66142FYA 100 µg
MO-AB-00080R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00080R 100 µg
MO-AB-00090L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00090L 100 µg
MO-AB-51098W Monoclonal Marmoset WB, ELISA MO51098W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Elephant (Loxodonta africana), Marmoset, Medaka (Oryzias latipes), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO25304FYA
SpecificityThis antibody binds to fruit fly Apoa1Bp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX.
Product OverviewMouse Anti-D. melanogaster Apoa1Bp Antibody is a mouse antibody against Apoa1Bp. It can be used for Apoa1Bp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNAD(P)H-hydrate epimerase; EC 5.1.99.6; NAD(P)HX epimerase
UniProt IDQ9W2Y3
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: MDLKYLNQKEAIAVDQELFNDYKFSVDQLMELAGLSCAHAVAKCFPAEKHPRILVCCGPGNNGGDGLVAARHLALMGYTPTIYYPKPTAKPLFENLSHQCQQMDICDVKECPSVESAARDYDLILDALFGFSFKPPVRADFVAVVELMQQTKLPIASVDIPSGWDVEKGKLTECDVEPALLISLTAPKLCARQFRGEHHYLGGRFVPPALQRKYELNLPVYPGNELCVKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry