Mouse Anti-apoa2 Antibody (CBMOAB-66143FYA)


Cat: CBMOAB-66143FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-66143FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus WB, ELISA MO66143FYA 100 µg
MO-AB-07485R Monoclonal Cattle (Bos taurus) WB, ELISA MO07485R 100 µg
MO-AB-10640Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10640Y 100 µg
MO-AB-23795R Monoclonal Pig (Sus scrofa) WB, ELISA MO23795R 100 µg
MO-AB-24111H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24111C 100 µg
MO-AB-28992W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28992W 100 µg
MO-AB-43693W Monoclonal Horse (Equus caballus) WB, ELISA MO43693W 100 µg
MO-AB-51099W Monoclonal Marmoset WB, ELISA MO51099W 100 µg
MOFY-0722-FY136 Polyclonal Rhesus WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus
CloneMO66143FYA
SpecificityThis antibody binds to Zebrafish apoa2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. (From NCBI)
Product OverviewMouse Anti-Zebrafish apoa2 Antibody is a mouse antibody against apoa2. It can be used for apoa2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:193613; apoa2; NP_001124058.
UniProt IDB3DFP9
Protein RefseqThe length of the protein is 141 amino acids long.
The sequence is show below: MKLTFALILALQVSVCVWAQEWPVPDKELVDKYDGLRTVFIKRLVNAWEKIKTAVEPALEGSPTAGSLKDVVEELKKSPRVESFIKIAGGLASELEPVVDKARLNALGVYGHYFRPYVGAYLDSAINNVKPVLDTVLPQGN.
For Research Use Only | Not For Clinical Use.
Online Inquiry