AibGenesis™ Mouse Anti-APOBEC1 Antibody (CBMOAB-36017FYA)


Cat: CBMOAB-36017FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36017FYA Monoclonal Rhesus (Macaca mulatta), Ferret (Mustela Putorius Furo), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO36017FYA 100 µg
MO-AB-07227Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07227Y 100 µg
MO-AB-24113H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24113C 100 µg
MO-AB-34402W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34402W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Ferret (Mustela Putorius Furo), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO36017FYA
SpecificityThis antibody binds to Rhesus APOBEC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus APOBEC1 Antibody is a mouse antibody against APOBEC1. It can be used for APOBEC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPOBEC1
UniProt IDF7FTF0
Protein RefseqThe length of the protein is 236 amino acids long.
The sequence is show below: MTSEKGPSTGDPTLRRRIEPWEFDIFYDPRELRKEACLLYEIKWGMSPKIWRSSGKNTTNHVEVNFIEKLTSERRFHSSISCSITWFLSWSPCWECSQAIREFLSQHPGVTLVIYVARLFWHTDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGEEAHWPRYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQMIPPHILLATGLIQPSVTWR.
For Research Use Only | Not For Clinical Use.
Online Inquiry