Mouse Anti-APOBEC2 Antibody (CBMOAB-36018FYA)


Cat: CBMOAB-36018FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36018FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO36018FYA 100 µg
MO-AB-01498H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01498C 100 µg
MO-AB-07489R Monoclonal Cattle (Bos taurus) WB, ELISA MO07489R 100 µg
MO-AB-24116H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24116C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO36018FYA
SpecificityThis antibody binds to Rhesus APOBEC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable C to U editing enzyme whose physiological substrate is not yet known. Does not display detectable apoB mRNA editing. Has a low intrinsic cytidine deaminase activity. May play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
Product OverviewMouse Anti-Rhesus APOBEC2 Antibody is a mouse antibody against APOBEC2. It can be used for APOBEC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative C-_U-editing enzyme APOBEC-2; APOBEC2
UniProt IDH9F7G4
Protein RefseqThe length of the protein is 137 amino acids long.
The sequence is show below: GYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRITKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDVQENFLYYEEKLADILK.
For Research Use Only | Not For Clinical Use.
Online Inquiry