Mouse Anti-APOBEC3C Antibody (CBMOAB-36022FYA)


Cat: CBMOAB-36022FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36022FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO36022FYA 100 µg
MO-AB-19334W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19334W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO36022FYA
SpecificityThis antibody binds to Rhesus APOBEC3C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. (From NCBI)
Product OverviewMouse Anti-Rhesus APOBEC3C Antibody is a mouse antibody against APOBEC3C. It can be used for APOBEC3C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPOBEC3C
UniProt IDF6XHB3
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: KRSHSTSEKSGTGSVSKRPNMNPQIRNPMKAMYPGTFYFQFKNLREANNRNETWLCFAVEIIKQRSTVPLKTGVFRNQVDLETHCHAERCFLSWFCEDILSPNTDYQVTWYTSWSPCLDCAGEVAKFLARHNNVMLTIYTARLYYSQYPNYQQGLRSLSEKGVSVKIMDYEDFKYCWEKFVYDDGEPFKPWKGLKTSFRFLKRRLREILQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry