AibGenesis™ Mouse Anti-apobec3F Antibody (CBMOAB-36027FYA)


Cat: CBMOAB-36027FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36027FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO36027FYA 100 µg
MO-AB-01094W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01094W 100 µg
MO-AB-07491R Monoclonal Cattle (Bos taurus) WB, ELISA MO07491R 100 µg
MO-AB-14215Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14215Y 100 µg
MO-AB-19338W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19338W 100 µg
MO-AB-23816R Monoclonal Pig (Sus scrofa) WB, ELISA MO23816R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO36027FYA
SpecificityThis antibody binds to Rhesus apobec3F.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. (From NCBI)
Product OverviewMouse Anti-Rhesus apobec3F Antibody is a mouse antibody against apobec3F. It can be used for apobec3F detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApolipoprotein B mRNA editing enzyme catalytic polypeptide-like 3F; apobec3F
UniProt IDQ1G0Z6
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: MQPQYRNTVERMYRGTFFYNFNNRPILSRRNTVWLCYEVKTRGPSMPTWDTKIFRGQVYSKPEHHAEMCFLSRFCGNQLPAYKRFQITWFVSWTPCPDCVAKVAEFLAEHPNVTLTISAARLYYYWETDYRRALCRLRQAGARVKIMDYEEFAYCWENFVYNEGQSFMPWDKFDDNYAFLHHKLKEILRNPMEATYPHIFYFHFKNLRKAYGRNETWLCFTMEIIKQHSTVSWETGVFRNQVDPESRCHAERCFLSWFCEDILSPNTDYQVTWYTSWSPCLDCAGEVAEFLARHSNVKLAIFAARLYYFWDTHYQQGLRSLSEKGASVEIMGYKDFKYCWENFVYNGDEPFKPWKGLKYNFLFLDSKLQEILE.
For Research Use Only | Not For Clinical Use.
Online Inquiry