AibGenesis™ Mouse Anti-APOBEC3H Antibody (CBMOAB-36059FYA)


Cat: CBMOAB-36059FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36059FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Horse (Equus caballus) WB, ELISA MO36059FYA 100 µg
MO-AB-08804W Monoclonal Cat (Felis catus) WB, ELISA MO08804W 100 µg
MO-AB-12628W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12628W 100 µg
MO-AB-43696W Monoclonal Horse (Equus caballus) WB, ELISA MO43696W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Horse (Equus caballus)
CloneMO36059FYA
SpecificityThis antibody binds to Rhesus APOBEC3H.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 family of proteins. The encoded protein is a cytidine deaminase that has antiretroviral activity by generating lethal hypermutations in viral genomes. Polymorphisms and alternative splicing in this gene influence its antiretroviral activity and are associated with increased resistence to human immunodeficiency virus type 1 infection in certain populations. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus APOBEC3H Antibody is a mouse antibody against APOBEC3H. It can be used for APOBEC3H detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA dC->dU-editing enzyme APOBEC-3H; APOBEC3H
UniProt IDF6SJ45
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: MALLTAKTFSLQFNNKRRVNKPYYPRKALLCYQLTPQNGSTPTRGHLKNKKKDHAEIRFINKIKSMGLDETQCYQVTCYLTWSPCPSCAGELVDFIKAHRHLNLRIFASRLYYHWRPNYQEGLLLLCGSQVPVEVMGLPEFTDCWENFVDHKEPPSFNPSEKLKELDKNSQAIKRRLERIKSRSVDVLENGLRSLQLGPVTPSSSIRNSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry