AibGenesis™ Mouse Anti-APOC3 Antibody (CBMOAB-36062FYA)


Cat: CBMOAB-36062FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36062FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Rat (Rattus norvegicus) WB, ELISA MO36062FYA 100 µg
MO-AB-07496R Monoclonal Cattle (Bos taurus) WB, ELISA MO07496R 100 µg
MO-AB-24119H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24119C 100 µg
MO-AB-28997W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28997W 100 µg
MO-AB-41253W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41253W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Rat (Rattus norvegicus)
CloneMO36062FYA
SpecificityThis antibody binds to Rhesus APOC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins (HDL) and chylomicrons. The encoded protein plays a role in role in the metabolism of these TRLs through multiple modes. This protein has been shown to promote the secretion of VLDL1, inhibit lipoprotein lipase enzyme activity, and delay catabolism of TRL remnants. Mutations in this gene are associated with low plasma triglyceride levels and reduced risk of ischemic cardiovascular disease, and hyperalphalipoproteinemia, which is characterized by elevated levels of high density lipoprotein (HDL) and HDL cholesterol in human patients. This gene and other related genes comprise an apolipoprotein gene cluster on chromosome 11. (From NCBI)
Product OverviewMouse Anti-Rhesus APOC3 Antibody is a mouse antibody against APOC3. It can be used for APOC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPOC3
UniProt IDF7FQN1
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: MQPRVLLVAALLSLLASARASEAEDTSLLGFMQDYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry