Mouse Anti-APOH Antibody (CBMOAB-36064FYA)


Cat: CBMOAB-36064FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36064FYA Monoclonal Rhesus (Macaca mulatta), Bovine, Cattle (Bos taurus), Dog (Canis lupus familiaris), Dog, Human WB, ELISA MO36064FYA 100 µg
MO-AB-07504R Monoclonal Cattle (Bos taurus) WB, ELISA MO07504R 100 µg
MO-AB-29000W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29000W 100 µg
MOFY-0722-FY212 Polyclonal Dog, Human WB, IHC, ICC, IP 100 µg
MOFY-0722-FY303 Polyclonal Bovine WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Bovine, Cattle (Bos taurus), Dog (Canis lupus familiaris), Dog, Human
CloneMO36064FYA
SpecificityThis antibody binds to Rhesus APOH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus APOH Antibody is a mouse antibody against APOH. It can be used for APOH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPOH
UniProt IDF6UM69
Protein RefseqThe length of the protein is 342 amino acids long.
The sequence is show below: MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSIVVPLKTFYEPGEEITYSCKPGYVSRGGMRRFICPLTGMWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTINFSCNTGFYLNGANSAKCTEEGQWSPGIPVCAPITCPPPSVPMFATLRVYKPSAGNNSFYQDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPLRPDNGFVNYPAKPVLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKTKCPLEQNILKCLSFSPPTEHSSLAFWKTDASDVKPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry