AibGenesis™ Mouse Anti-APOM Antibody (MO-AB-23822R)


Cat: MO-AB-23822R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23822R Monoclonal Pig (Sus scrofa), Cattle (Bos taurus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO23822R 100 µg
CBMOAB-36074FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36074FYA 100 µg
CBMOAB-66182FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66182FYA 100 µg
MO-AB-51108W Monoclonal Marmoset WB, ELISA MO51108W 100 µg
MO-AB-07509R Monoclonal Cattle (Bos taurus) WB, ELISA MO07509R 100 µg
MO-AB-06306Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06306Y 100 µg
MO-AB-14222Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14222Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Cattle (Bos taurus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO23822R
SpecificityThis antibody binds to Pig APOM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. (From NCBI)
Product OverviewThis product is a mouse antibody against APOM. It can be used for APOM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApolipoprotein M; APOM
UniProt IDA5D9L6
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: MAAGSVPMQLQLRATIRTKNGLCVPRKWIYRLSEGNTDLRTEGRPDMKTKLFSSTCPGGIMLKETGQGYQRFLLYNRSPHPPEKCVEEFQSLTSCLDFKAFLLTPRNQEACELSSN.
See other products for " Apom "
For Research Use Only | Not For Clinical Use.
Online Inquiry