Mouse Anti-ApoN Antibody (MO-AB-07511R)


Cat: MO-AB-07511R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07511R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO07511R 100 µg
MO-AB-23823R Monoclonal Pig (Sus scrofa) WB, ELISA MO23823R 100 µg
MO-AB-24125H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24125C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO07511R
SpecificityThis antibody binds to Cattle ApoN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ApoN Antibody is a mouse antibody against ApoN. It can be used for ApoN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOvarian and testicular apolipoprotein N; ApoN
UniProt IDQ68RU0
Protein RefseqThe length of the protein is 259 amino acids long.
The sequence is show below: MMRAVLLLCCVLMSPVAAFPRNAQEGVLTFQPSISEIGHPLNLLSNQLLSNQILLPDPKTCQDLLHVAPSLAPLPEYLSNLALEVVLEEIGCTTEAHILQLQLVKIGGKDTTETLIRESKKHNEGEGTGQVKVILKDLGRSPGELRRAQRSVTLPEACRQEDRWVLYETAKMIAEFAEKLPNTELVKEFKAAATDVTQKCTDESWEYLQAVSNQLVKSPEMKDFTMPMQDQLYFIKRSMTILMHIVVEFIKTQVQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry