Mouse Anti-APRL3 Antibody (CBMOAB-18623FYB)


Cat: CBMOAB-18623FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18623FYB Monoclonal Rice (Oryza), Maize (Zea mays) WB, ELISA MO18623FYB 100 µg
MO-AB-47346W Monoclonal Maize (Zea mays) WB, ELISA MO47346W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Maize (Zea mays)
CloneMO18623FYB
SpecificityThis antibody binds to Rice APRL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice APRL3 Antibody is a mouse antibody against APRL3. It can be used for APRL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names5'-adenylylsulfate reductase-like 3; Adenosine 5'-phosphosulfate reductase-like 3; APR-like 3; OsAPRL3; APRL3; Os02g0754900 LOC_Os02g51850
UniProt IDQ84P95
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MATRLLCWTALLLPIIAATAAASPLPEACPVPTAAEEILGPGGTCTTLDRRGDPVGVIEGDEVTLAKAITLLHMNKDDYIAVLFYASWCPFSQECKPNFEILASLFPSIRHFAFEESSIRPSIISRYGIHGFPTLFLLNSTMRVRYHGPRTVKSLAAFYRDVSGFDVSMTSEAVLHSVDGIELKKDAEQENCPFWWARSPEKILQQDTYLALATAFVILRLLYLLFPKIGSFAKRAWRRHTLFPNLVGVHEYFFTYLEQARHKFFRLYPSKRGNLQEGARNATAWASKSLASVSIGEPSTIGRTNSTNELR.
For Research Use Only | Not For Clinical Use.
Online Inquiry