Mouse Anti-APRL4 Antibody (CBMOAB-18624FYB)


Cat: CBMOAB-18624FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18624FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays) WB, ELISA MO18624FYB 100 µg
CBMOAB-2300FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO2300FC 100 µg
MO-AB-47347W Monoclonal Maize (Zea mays) WB, ELISA MO47347W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays)
CloneMO18624FYB
SpecificityThis antibody binds to Rice APRL4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice APRL4 Antibody is a mouse antibody against APRL4. It can be used for APRL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names5'-adenylylsulfate reductase-like 4; Adenosine 5'-phosphosulfate reductase-like 4; APR-like 4; OsAPRL4; APRL4; Os08g0412401 LOC_Os08g31814
UniProt IDQ5DJV7
Protein RefseqThe length of the protein is 264 amino acids long.
The sequence is show below: MAAATASASASASAAAFLLLPLLAAAATAGHGVCPRQPAAAAVLPRQSSCPAAGSPGHRAHHVGVVEGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEESRIKPRMLSRYGVRAFPTLFLVNSTMRVRYHGSRTMNSLAMFYKDVTGMNPVSLDAISLERMEEVVNIIENDKKTEQGDSLFMFARSPDRLLHQDTCLALASSFVLMRLLCFLLPKLNACVKQAWRMQFYELKRLLSNLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry