Mouse Anti-Arabidopsis ABI3 Antibody (CBMOAB-1381FYC)
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
- Relate Reference Data
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana) |
| Clone | MO1381FC |
| Specificity | This antibody binds to Arabidopsis ABI3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of an adaptor protein family. Members of this family encode proteins containing a homeobox homology domain, proline rich region and Src-homology 3 (SH3) domain, and are components of the Abi/WAVE complex which regulates actin polymerization. The encoded protein inhibits ectopic metastasis of tumor cells as well as cell migration. This may be accomplished through interaction with p21-activated kinase. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Arabidopsis ABI3 (clone MO1381FC) Antibody (CBMOAB-1381FYC) is a mouse antibody against ABI3. It can be used for ABI3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ABI Family Member 3; New Molecule Including SH3; NESH; ABI Gene Family Member 3; ABI Family, Member 3; SSH3BP3 |
| UniProt ID | A6N2P2 |
| Protein Refseq | The length of the protein is 255 amino acids long. The sequence is show below: DNNHVHGHQDDDLIVHHDPSIFYGDLPTLPDFPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAILRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQGFGCGEGGGDCIDMMETFGYMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMLENNSGGDMQMMNSSLEQDDDLATVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEWVQ. |
Reference
| Reference | Ding, Z. J., Yan, J. Y., Li, G. X., Wu, Z. C., Zhang, S. Q., & Zheng, S. J. (2014). WRKY 41 controls Arabidopsis seed dormancy via direct regulation of ABI 3 transcript levels not downstream of ABA. The Plant Journal, 79(5), 810-823. |
| MO-DKB-03965W | Rabbit Anti-ABI3 (C-terminal) Antibody (Cat MO-DKB-03965W) |
| MO-AB-50244W | Mouse Anti-Marmoset ABI3 Antibody (MO-AB-50244W) |
| MO-DKB-03966W | Rabbit Anti-ABI3 (N-terminal) Antibody (Cat MO-DKB-03966W) |
| MO-AB-06811R | Mouse Anti-Cattle ABI3 Antibody (MO-AB-06811R) |
| MO-AB-34080H | Mouse Anti-Tomato ABI3 Antibody (MO-AB-34080H) |
| MO-DKB-02766W | Rabbit Anti-ABI3 Antibody (MO-DKB-02766W) |
| MO-AB-27237W | Mouse Anti-Cottonwood ABI3 Antibody (MO-AB-27237W) |
Figure 1 Lack of WRKY41 reduces the expression of ABA signaling and seed maturation genes. The expression of ABA signaling and seed maturation genes was determined in Col-0 (black), wrky41-1 (white) and wrky41-1 complemented line 2 (gray).
Reference: Ding, Z. J., Yan, J. Y., Li, G. X., Wu, Z. C., Zhang, S. Q., & Zheng, S. J. (2014). WRKY 41 controls Arabidopsis seed dormancy via direct regulation of ABI 3 transcript levels not downstream of ABA. The Plant Journal, 79(5), 810-823.
Figure 2 WRKY41 binds to the W-boxes of the ABI3 promoter in vitro and transactivates ABI3 in Nicotiana benthamiana (tobacco) leaves. Diagram of the ABI3 promoter showing three adjacent W-boxes ~1.8 kb upstream of the transcription start site (TSS). PABI3 and mP probes (see main text) were used in EMSA, with the TTGAC of each W-box changed to TTGAA in the mP probe. EMSA analysis showing binding of WRKY41 to PABI3 (but not mP). The arrow indicates the retardation band indicative of probe binding; the asterisk indicates free probe. The increased concentration of proteins (0.2 and 1 lg) and competitors (1009 and 2009) are indicated by white and black triangles, respectively.
Reference: Ding, Z. J., Yan, J. Y., Li, G. X., Wu, Z. C., Zhang, S. Q., & Zheng, S. J. (2014). WRKY 41 controls Arabidopsis seed dormancy via direct regulation of ABI 3 transcript levels not downstream of ABA. The Plant Journal, 79(5), 810-823.