Mouse Anti-Arabidopsis ABI3 Antibody (CBMOAB-1381FYC)


Cat: CBMOAB-1381FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target
  • Reference
  • Relate Reference Data

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO1381FC
SpecificityThis antibody binds to Arabidopsis ABI3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of an adaptor protein family. Members of this family encode proteins containing a homeobox homology domain, proline rich region and Src-homology 3 (SH3) domain, and are components of the Abi/WAVE complex which regulates actin polymerization. The encoded protein inhibits ectopic metastasis of tumor cells as well as cell migration. This may be accomplished through interaction with p21-activated kinase. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Arabidopsis ABI3 (clone MO1381FC) Antibody (CBMOAB-1381FYC) is a mouse antibody against ABI3. It can be used for ABI3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABI Family Member 3; New Molecule Including SH3; NESH; ABI Gene Family Member 3; ABI Family, Member 3; SSH3BP3
UniProt IDA6N2P2
Protein RefseqThe length of the protein is 255 amino acids long. The sequence is show below: DNNHVHGHQDDDLIVHHDPSIFYGDLPTLPDFPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAILRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQGFGCGEGGGDCIDMMETFGYMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMLENNSGGDMQMMNSSLEQDDDLATVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEWVQ.

Reference

ReferenceDing, Z. J., Yan, J. Y., Li, G. X., Wu, Z. C., Zhang, S. Q., & Zheng, S. J. (2014). WRKY 41 controls Arabidopsis seed dormancy via direct regulation of ABI 3 transcript levels not downstream of ABA. The Plant Journal, 79(5), 810-823.

Relate Reference Data

Figure 1 Lack of WRKY41 reduces the expression of ABA signaling and seed maturation genes. The expression of ABA signaling and seed maturation genes was determined in Col-0 (black), wrky41-1 (white) and wrky41-1 complemented line 2 (gray).
Reference: Ding, Z. J., Yan, J. Y., Li, G. X., Wu, Z. C., Zhang, S. Q., & Zheng, S. J. (2014). WRKY 41 controls Arabidopsis seed dormancy via direct regulation of ABI 3 transcript levels not downstream of ABA. The Plant Journal, 79(5), 810-823.

Figure 2 WRKY41 binds to the W-boxes of the ABI3 promoter in vitro and transactivates ABI3 in Nicotiana benthamiana (tobacco) leaves. Diagram of the ABI3 promoter showing three adjacent W-boxes ~1.8 kb upstream of the transcription start site (TSS). PABI3 and mP probes (see main text) were used in EMSA, with the TTGAC of each W-box changed to TTGAA in the mP probe. EMSA analysis showing binding of WRKY41 to PABI3 (but not mP). The arrow indicates the retardation band indicative of probe binding; the asterisk indicates free probe. The increased concentration of proteins (0.2 and 1 lg) and competitors (1009 and 2009) are indicated by white and black triangles, respectively.
Reference: Ding, Z. J., Yan, J. Y., Li, G. X., Wu, Z. C., Zhang, S. Q., & Zheng, S. J. (2014). WRKY 41 controls Arabidopsis seed dormancy via direct regulation of ABI 3 transcript levels not downstream of ABA. The Plant Journal, 79(5), 810-823.

For Research Use Only | Not For Clinical Use.
Online Inquiry