Mouse Anti-Arabidopsis ACD1 Antibody (CBMOAB-0753FYC)
Cat: CBMOAB-0753FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana) |
| Clone | MO0753FC |
| Specificity | This antibody binds to Arabidopsis ACD1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Acd1 (accelerated cell death 1) EC=1.14.12.20 is an enzyme involved in chlorophyll breakdown, pheophorbide a oxygenase. This enzyme seems to induce cell death in Arabidopsis leaves in the dark. |
| Product Overview | Mouse Anti-Arabidopsis ACD1 Antibody is a mouse antibody against ACD1. It can be used for ACD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Accelerated cell death 1; Fragment; ACD1 |
| UniProt ID | B0ZTT9 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: PFQLLGRDLVLWFDRNDQKWAAFDDLCPHRLAPLSEGRLDENGHLQCSYHGWSFGGCGSCTRIPQAATSGPEARAVKSXXXCAXKXPXMVSQ. |
See other products for " ACD1 "
| CBMOAB-00239HCB | Mouse Anti-C. elegans ACD1 Antibody (CBMOAB-00239HCB) |
| MO-DKB-0019RA | Rabbit Anti-ACD1 Antibody (MO-DKB-0019RA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry