Mouse Anti-Arabidopsis AK5 Antibody (CBMOAB-1983FYC)
Cat: CBMOAB-1983FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO1983FC |
Specificity | This antibody binds to Arabidopsis AK5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
Product Overview | Mouse Anti-Arabidopsis AK5 Antibody is a mouse antibody against AK5. It can be used for AK5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate Kinase 5; ATP-AMP Transphosphorylase 5; AK 5; Adenylate Kinase Isoenzyme 5; Adenylate Kinase 6; EC 2.7.4.3; EC 2.7.4.6; AK6 |
UniProt ID | Q38992 |
Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: KASNILLDADMHPKISDFGMARIFGVDQTQANTKRIVGTYGYMSPEYAIHGKYSVKS. |
See other products for " AK5 "
MO-AB-50642W | Mouse Anti-Marmoset AK5 Antibody (MO-AB-50642W) |
MO-AB-23654R | Mouse Anti-Pig AK5 Antibody (MO-AB-23654R) |
MO-AB-21173W | Mouse Anti-Chimpanzee AK5 Antibody (MO-AB-21173W) |
MO-AB-07177R | Mouse Anti-Cattle Ak5 Antibody (MO-AB-07177R) |
CBMOAB-65348FYA | Mouse Anti-Zebrafish ak5 Antibody (CBMOAB-65348FYA) |
CBMOAB-35400FYA | Mouse Anti-Rhesus AK5 Antibody (CBMOAB-35400FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry