Mouse Anti-Arabidopsis AK5 Antibody (CBMOAB-1983FYC)


Cat: CBMOAB-1983FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO1983FC
SpecificityThis antibody binds to Arabidopsis AK5.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Product OverviewMouse Anti-Arabidopsis AK5 (clone MO1983FC) Antibody (CBMOAB-1983FYC) is a mouse antibody against AK5. It can be used for AK5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate Kinase 5; ATP-AMP Transphosphorylase 5; AK 5; Adenylate Kinase Isoenzyme 5; Adenylate Kinase 6; EC 2.7.4.3; EC 2.7.4.6; AK6
UniProt IDQ38992
Protein RefseqThe length of the protein is 57 amino acids long. The sequence is show below: KASNILLDADMHPKISDFGMARIFGVDQTQANTKRIVGTYGYMSPEYAIHGKYSVKS.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry