Mouse Anti-Arabidopsis AOC1 Antibody (CBMOAB-2174FYC)


Cat: CBMOAB-2174FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO2174FC
SpecificityThis antibody binds to Arabidopsis AOC1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product OverviewMouse Anti-Arabidopsis AOC1 (clone MO2174FC) Antibody (CBMOAB-2174FYC) is a mouse antibody against AOC1. It can be used for AOC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAmine Oxidase, Copper Containing 1; Diamine Oxidase; Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)); Amine Oxidase Copper Domain-Containing Protein 1; Amiloride-Binding Protein 1; Kidney Amine Oxidase; Histaminase; ABP1
UniProt IDQ9LS03
Protein RefseqThe length of the protein is 254 amino acids long. The sequence is show below: MASSTISLQSISMTTLNNLSYSKQFHRSSLLGFSKSFQNFGISSNGPGSSSPTSFTPKKKLTPTRALSQNLGNTENPRPSKVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELIGTPVPPSKDVEPAPEAKALKPSGVVSNFTN.
For Research Use Only | Not For Clinical Use.

Online Inquiry