Mouse Anti-Arabidopsis AT1G49975 Antibody (CBMOAB-5830FYC)


Cat: CBMOAB-5830FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO5830FC
SpecificityThis antibody binds to Arabidopsis AT1G49975.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AT1G49975 Antibody is a mouse antibody against AT1G49975. It can be used for AT1G49975 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAT1G49975 protein; At1g49975
UniProt IDC0Z2X5
Protein RefseqThe length of the protein is 75 amino acids long. The sequence is show below: MSSISQSILMALTVTVNKYASSNVQAVRRNDTKRHSLTAPPADLGRRNILFSSTSFIAAALTSSDQLLQKLFQSI.
For Research Use Only | Not For Clinical Use.
Online Inquiry