Mouse Anti-Arabidopsis AT1G49975 Antibody (CBMOAB-5830FYC)
Cat: CBMOAB-5830FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Specifications
- Application Information
- Target
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO5830FC |
Specificity | This antibody binds to Arabidopsis AT1G49975. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Arabidopsis AT1G49975 Antibody is a mouse antibody against AT1G49975. It can be used for AT1G49975 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | AT1G49975 protein; At1g49975 |
UniProt ID | C0Z2X5 |
Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: MSSISQSILMALTVTVNKYASSNVQAVRRNDTKRHSLTAPPADLGRRNILFSSTSFIAAALTSSDQLLQKLFQSI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry