Mouse Anti-Arabidopsis AT1G53210 Antibody (CBMOAB-6052FYC)
Cat: CBMOAB-6052FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Specifications
- Application Information
- Target
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO6052FC |
Specificity | This antibody binds to Arabidopsis AT1G53210. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Possesses sodium/calcium exchanger (NCX) activity when expressed in a heterologous mammalian CHO-K1 cell system (PubMed:23148213). Does not possess cation/proton exchanger (CAX) or sodium/proton (NHX) activity when expressed in a heterologous yeast cell system. Has the ability to bind calcium in vitro. Participates in the maintenance of calcium homeostasis (PubMed:23148213, PubMed:26296956). May play a role in auxin response, diurnal rhythm and flowering time (PubMed:26296956). Involved in salt stress response (PubMed:23148213). (From uniprot, under CC BY 4.0) |
Product Overview | Mouse Anti-Arabidopsis AT1G53210 Antibody is a mouse antibody against AT1G53210. It can be used for AT1G53210 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Putative uncharacterized protein At1g53210; Fragment; At1g53210 |
UniProt ID | Q67YI4 |
Protein Refseq | The length of the protein is 45 amino acids long. The sequence is show below: FVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGWS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry