Mouse Anti-Arabidopsis AT1G53210 Antibody (CBMOAB-6052FYC)


Cat: CBMOAB-6052FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO6052FC
SpecificityThis antibody binds to Arabidopsis AT1G53210.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPossesses sodium/calcium exchanger (NCX) activity when expressed in a heterologous mammalian CHO-K1 cell system (PubMed:23148213). Does not possess cation/proton exchanger (CAX) or sodium/proton (NHX) activity when expressed in a heterologous yeast cell system. Has the ability to bind calcium in vitro. Participates in the maintenance of calcium homeostasis (PubMed:23148213, PubMed:26296956). May play a role in auxin response, diurnal rhythm and flowering time (PubMed:26296956). Involved in salt stress response (PubMed:23148213). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Arabidopsis AT1G53210 Antibody is a mouse antibody against AT1G53210. It can be used for AT1G53210 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein At1g53210; Fragment; At1g53210
UniProt IDQ67YI4
Protein RefseqThe length of the protein is 45 amino acids long. The sequence is show below: FVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGWS.
For Research Use Only | Not For Clinical Use.
Online Inquiry