Mouse Anti-Arabidopsis AT4G24000 Antibody (CBMOAB-17899FYC)


Cat: CBMOAB-17899FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO17899FC
SpecificityThis antibody binds to Arabidopsis AT4G24000.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGlycosyltransferases are enzymes that catalyze the formation of the glycosidic linkage to form a glycoside. These enzymes utilize ''activated'' sugar phosphates as glycosyl donors, and catalyze glycosyl group transfer to a nucleophilic group, usually an alcohol.
Product OverviewMouse Anti-Arabidopsis AT4G24000 Antibody is a mouse antibody against AT4G24000. It can be used for AT4G24000 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein At4g24000; At4g24000
UniProt IDQ56WT1
Protein RefseqThe length of the protein is 68 amino acids long. The sequence is show below: MRGLYGIFTWGEGPVLELMLASFAVVNCLPIYEAMVLRIDDGKLPKRICFLAGLLSFVLTGSGYFFLK.
See other products for " AT4G24000 "
CBMOAB-61703FYCMouse Anti-A. thaliana AT4G24000 Antibody (CBMOAB-61703FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry