AibGenesis™ Mouse Anti-Arabidopsis AT5G15320 Antibody (CBMOAB-0187FYC)


Cat: CBMOAB-0187FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO0187FC
SpecificityThis antibody binds to Arabidopsis AT5G15320.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AT5G15320 Antibody is a mouse antibody against AT5G15320. It can be used for AT5G15320 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAt5g15320; GPI-anchored protein; At5g15320 At5g15320/F8M21_210
UniProt IDQ8GXE7
Protein RefseqThe length of the protein is 53 amino acids long. The sequence is show below: MTLPPGLYSGTSSLALVARASAFGLGLVYGNMKLKVLKIKSMSQKKVEATAHH.
For Research Use Only | Not For Clinical Use.
Online Inquiry