Mouse Anti-Arabidopsis ATPC Antibody (CBMOAB-24873FYC)
Cat: CBMOAB-24873FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO24873FC |
Specificity | This antibody binds to Arabidopsis ATPC. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Chloroplast; Endoplasmic reticulum; Cell Wall; Other locations; Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Mitochondrial membrane ATP synthase (FF ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F - containing the extramembraneous catalytic core, and F - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alphabeta. Rotation of the central stalk against the surrounding alphabeta subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. |
Product Overview | Mouse Anti-Arabidopsis ATPC Antibody is a mouse antibody against ATPC. It can be used for ATPC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP synthase subunit gamma, mitochondrial; F-ATPase gamma subunit; ATPC; At2g33040 |
UniProt ID | Q96250 |
Protein Refseq | The length of the protein is 325 amino acids long. The sequence is show below: MAMAVFRREGRRLLPSIAARPIAAIRSPLSSDQEEGLLGVRSISTQVVRNRMKSVKNIQKITKAMKMVAASKLRAVQGRAENSRGLWQPFTALLGDNPSIDVKKSVVVTLSSDKGLCGGINSTVVKVSRALYKLNAGPEKEVQFVIVGEKAKAIMFRDSKNDIVLSVTELNKNPLNYAQVSVLADDILKNVEFDALRIVYNKFHSVVAFLPTVSTVLSPEIIEKESEIGGKLGELDSYEIEGGETKGEILQNLAEFQFSCVMFNAVLENACSEMGARMSAMDSSSRNAGEMLDRLTLTYNRTRQASITTELIEIISGASALEAAK. |
See other products for " AtpC "
MO-DKB-02043W | Rabbit Anti-AtpC Antibody (MO-DKB-02043W) |
CBMOAB-0214YC | Mouse Anti-E. coli atpC Antibody (CBMOAB-0214YC) |
MO-AB-31078H | Mouse Anti-Soybean ATPC Antibody (MO-AB-31078H) |
MO-DKB-01832W | Rabbit Anti-AtpC Antibody (MO-DKB-01832W) |
MO-DKB-0072RA | Rabbit Anti-AtpC Antibody (MO-DKB-0072RA) |
MOFAB-291W | Rabbit Anti-ATPC Antibody (MOFAB-291W) |
MO-DKB-01643W | Rabbit Anti-AtpC Antibody (MO-DKB-01643W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry