Mouse Anti-ATPC Antibody (MO-AB-31078H)


Cat: MO-AB-31078H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-31078H Monoclonal WB, ELISA MO31078C 100 µg
MO-DKB-0072RA Polyclonal WB, ELISA 100 µL
MO-DKB-01643W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySoybean (Glycine max), A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); C. reinhardtii (Chlamydomonas reinhardtii); C. sorokiniana (Chlorella sorokiniana); C. vulgaris (Chlorella vulgaris); E. crus-galli (Echinochloa crus-galli); P. patens (Phycomitrella patens); P. sativum (Pisum sativum); Maize (Zea mays)
CloneMO31078C
SpecificityThis antibody binds to Soybean ATPC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMitochondrial membrane ATP synthase (FF ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F - containing the extramembraneous catalytic core, and F - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alphabeta. Rotation of the central stalk against the surrounding alphabeta subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. (From uniprot, under CC BY 4.0)
Product OverviewThis product is a mouse antibody against ATPC. It can be used for ATPC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChloroplastic ATP synthase gamma subunit; ATPC
UniProt IDA2TDD4
Protein RefseqThe length of the protein is 65 amino acids long.
The sequence is show below: SLFVSEEVDKVELLYTKFVSLVKSDPVIHTLLPLSPKGEICDVNGVCVDAAEDEFFRLTTKEGKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry